PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589065.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 1688aa    MW: 185462 Da    PI: 6.6782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589065.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-09814855346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e+++d  + +G++ +++Ia+ +  ++t  +c+++++k
   XP_009589065.1 814 PWTSEEREIFIDKLAIFGKD-FRKIASFLD-HKTTADCIEFYYK 855
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding30.21.1e-0910321072345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE  ++++av  +G++ +  ++r++  +R+++qck ++ 
   XP_009589065.1 1032 DWTDEEKSIFIQAVSAYGKD-FVMVSRCVR-TRSREQCKIFFS 1072
                       5*****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-14797858IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-6805856IPR009057Homeodomain-like
PROSITE profilePS5129316.517810861IPR017884SANT domain
SMARTSM007171.7E-9811859IPR001005SANT/Myb domain
PfamPF002491.8E-6813855IPR001005SANT/Myb domain
PROSITE profilePS5129311.7110281079IPR017884SANT domain
SMARTSM007178.2E-910291077IPR001005SANT/Myb domain
SuperFamilySSF466894.52E-1010301079IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-510321073IPR009057Homeodomain-like
PfamPF002494.7E-710321071IPR001005SANT/Myb domain
CDDcd001676.19E-710331071No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1688 aa     Download sequence    Send to blast
MPSEPLPWDR KDFFKERRQH DRSELLRGGP RWREPPPRHH YGSSRWVPAD FRPTRGAPPG  60
HGKQGSWHMY PEESGHGFMP SRSNEKIVDD ESCRQSRGDG GGKYGSRSSS RENRSFGGQR  120
DWRRGGGLSW EAAASPSGPV RQHDTATNDQ RPADVMVPHN SEHVNNTWEQ SHSRDQHNKS  180
GSANGTASTG QRFERGNSLG SIEWRPLKWA RSGSLSSRGS LSHSGSSKSM GVDSNETKPE  240
LQPGNSKALQ SPTGDATACV TSAAPSEETF SRKKPRLGWG EGLAKYEKKK VPEDSAAKVG  300
ACISGDSVEP GHPHPLNTAD KSPRVAVSLD CPSPATPSSV ACSSSPGLED KQPVKATNID  360
QDVGNLCGSP SIISQYHSEE FAFNLENFDL SQISNLNSSI NELLQSEDSS SVDSGFMRST  420
AVNKLLIWKN DISKVLEKTE VEIDSLENEL KTMISEPEYT QLVPSGSCSP RKECNSNSHE  480
DRGTTDIASR PAPLQVVIPE DVIGQEGTNI QEKEHTEVKV EDIDSPGSAT SKFVELPSEK  540
DTAPVDAMKH VGGMLISDDS KSLSNNVKVC SSTEDKAKSR SSDVKVCSFS EDMARDTLAC  600
GESSQLTARC SRPVSDGSLN CGKDALYNLI LAANKDTAYR AFDVFKNLLP AGKCSFDFSS  660
VSSLQIDHAV KERFARRKQF KQFKEKIIAL KFRVHQHLWK EDMRMLSARK FRAKSQKKFD  720
FSLRPVQIGH QKHRSTVRSR FLTTVGKSNL VPSSEVLNFA SRLLSDLRTK VYRNTLRMPA  780
LVLDQERTMS RFISKNSLVE DPCAVEKERS VINPWTSEER EIFIDKLAIF GKDFRKIASF  840
LDHKTTADCI EFYYKNHKSD CFERTKRKSD YSKQAKVCSA NTYLVASSGK RWNRESNSVS  900
LDILGAASAI AANVEDSIEI QQKCTSKYSV RMVTEHKTSR HNELERSNSL DVCHSERERV  960
AADVLTGICG SLSSEAMSSC ITSSIDPAEG NQEWKHQKVG SLTRLPLTPE VTQSVDDETC  1020
SDESCGEMDP TDWTDEEKSI FIQAVSAYGK DFVMVSRCVR TRSREQCKIF FSKARKCLGL  1080
DKILPGPGNL VRQDVNGGND PDACVMETEL FCNEKSSLKL KELSDLCVSA GISKPDMTSF  1140
DDKDGAGELD SVDTELVSKN SVQVNCHVDK QRVEFNRHCE IHIGACTENG RGDENMVTVS  1200
QEGGVQIDGD VSENGPADIL CANKVSGEHL GEEIKEVVPE RDFKNRKADS AEVSRSNFFL  1260
EDTESSMVSS RSNSRLAAVR GGELCPLNGS QNTTLLESDS ECKPDVNYSE SNISVQRKKM  1320
PRASNAVYLS ELELENVGDQ QRENATQSAE QPLPSTSQIA HVDSRQILGS YSLGESATKE  1380
SGDGCSTSAA LQEIQKVGKN LRSDTSSTTG FFLQRCNGTN REQTVGGSSS NVDKPCRNGD  1440
VKLFGQILSK PCPQANTSSN AQQSDSSNQQ LKVCSNMSSA THSLDGNSAT AKFERNNFLG  1500
SENHQVRSFG FWDGNRIQTG FSSLPDSAIL LAKYPAAFGN YAIASSKVEQ QPPLHGVVKT  1560
ATERSLNGVP VFPTRDVSSN NGVAAADYQV YRSLDVQPFT IEMKQRQDAV FSEMQRRNGF  1620
DVVSSMQQQA RGVVVGRGGI LVGGQCTGVS DPVAAIKMHY AKAEQFSGQA TSIIREDDYW  1680
LSKGDISR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-15773863494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-15773863494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589065.10.0PREDICTED: uncharacterized protein LOC104086495
TrEMBLA0A0V0J0A30.0A0A0V0J0A3_SOLCH; Putative ovule protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59042332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-150MYB family protein